The human prion protein and its normal processing |
|
|
Sequence of the human prion protein |
Significance |
|
manlgcwmlvlfvatwsdlglckkrpkpggwntggsrypgqgspggnryppqggggwgqp hgggwgqphgggwgqphgggwgqphgggwgqgggthsqwnkpskpktnmkhmagaaaaga vvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcv nitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqrgssmvlfssppv illisfliflivg
|
hPrPC, the ‘normal’ human protein consists of 253 amino acids and is synthesized from mRNA within the cell, the protein does not remain intact but is processed on its way to the cell surface |
|
Prion protein regions and processing |
Significance |
|
manlgcwmlvlfvatwsdlglc |
hydrophobic leader sequence removed before sending to cell surface, specific forms of neurodegeneration occur if the leader sequence is not removed and a transmembrane form of the protein results |
|
pqggggwgq-phgggwgq-phgggwgq-phgggwgq-phgggwgq |
octapeptide repeats are found within
the protein |
|
c |
cysteine residues involved in cystine (C-C) bond formation |
|
n |
asparagine-linked (N-glycosidic) carbohydrates added to these residues, glycosylation patterns vary between some TSEs |
|
s |
(GPI) glycosyl phosphatidylinositol moiety attached (membrane anchor), digesting this moiety gives PrPC its PI-PLC sensitivity and releases it from cells |
|
mvlfssppvillisfliflivg |
carboxy terminus removed before sending to cell surface |
|
kkrpkpggwntggsrypgqgspggnryppqggggwgqphgggwgqphgggwgqphgggwg qphgggwgqgggthsqwnkpskpktnmkhmagaaaagavvgglggymlgsamsrpiihfg sdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitikqhtvttttkgenftetd vkmmervveqmcitqyeresqayyqrgs |
the mature peptide found
in 'normal' tissues |
|
Truncated forms of the human PrPrSc '27-30' found in amyloid plaques |
|
|
gqphgggwgqphgggwgqphgggwgqphgggwgqgggthsqwnkpskpktnmkhmagaaa agavvgglggymlgsamsrpiihfgsdyedryy
wgqphgggwgqgggthsqwnkpskpktnmkhmagaaaagavvgglggymlgsamsrpiih fgsdyedryy
|
GSS (F198S) major peptides (58-150 and 81-150) found within amyloid plaques (mature-sized protein is found at the periphery of plaques)
|
|
wgqphgggwgqgggthsqwnkpskpktnmkhmagaaaagavvgglggymlgsamsrpiih fgsdye
|
GSS (A117V & Q217R) major peptide (81-146) found within amyloid plaques
|
|
~gqgggthsqwnkpskpktnmkhmagaaaagavvgglggymlgsamsrpiihfgsdyedr yyrenmhrypnqvyyr~
|
GSS (P102L) major peptide (~90~160) found within amyloid plaques |
|
In short, a protease-resistant central core of the prion protein ranging in size from 27 to 30kDa is found in amyloid plaques of GSS patients and vCJD patients (although rare in BSE itself) and 75% of Kuru cases, but such amyloid plaques are only found in 5-10% of other CJD patients.
Note: the polypeptides found in amyloid plaques have loss their GPI anchor, glycosylation sites and structure-stabilizing cystine bond. At this point their tertiary structure is believed to be drastically different than that of the original protein. |
|
The processing of the PrP protein is shown graphically below with many of the important landmarks indicated. The amino acid (a.a) locations vary (ex. 20/23) dependent of the species of interest.
